PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa03008s010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-other
Protein Properties Length: 163aa    MW: 19202.6 Da    PI: 8.7719
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa03008s010.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox642.1e-202879556
                    SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    +++t++q+++Le+ F+++++p++++r++L+++lgL  rq+k+WFqNrR+++k
  Csa03008s010.1 28 HRHTPHQIQRLESTFNECQHPDEKQRTQLSRELGLAPRQIKFWFQNRRTQKK 79
                    689**********************************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.84E-20881IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-221075IPR009057Homeodomain-like
PROSITE profilePS5007117.7672181IPR001356Homeobox domain
SMARTSM003891.9E-182285IPR001356Homeobox domain
PfamPF000465.3E-182879IPR001356Homeobox domain
CDDcd000862.92E-162882No hitNo description
PRINTSPR000312.8E-55261IPR000047Helix-turn-helix motif
PROSITE patternPS0002705679IPR017970Homeobox, conserved site
PRINTSPR000312.8E-56177IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MNMEFFGDSQ NHDGSETDKK NKKKKRFHRH TPHQIQRLES TFNECQHPDE KQRTQLSREL  60
GLAPRQIKFW FQNRRTQKKA QHERADNCAL KEENDKIRCE NIAIREAIKH AICPNCGDSP  120
LNDDAYFDEQ KLRIENAQLR DELERVSSIA AKFIGRPISH LPP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4934650.0AB493465.1 Arabidopsis thaliana At1g17920 mRNA for hypothetical protein, partial cds, clone: RAAt1g17920.
GenBankAF4245540.0AF424554.1 Arabidopsis thaliana At1g17920/F2H15_22 mRNA, complete cds.
GenBankBT0010500.0BT001050.1 Arabidopsis thaliana At1g17920/F2H15_22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010476956.11e-116PREDICTED: homeobox-leucine zipper protein HDG12
RefseqXP_010498166.11e-115PREDICTED: homeobox-leucine zipper protein HDG12-like
RefseqXP_010498167.11e-115PREDICTED: homeobox-leucine zipper protein HDG12-like
SwissprotQ9LMT81e-104HDG12_ARATH; Homeobox-leucine zipper protein HDG12
TrEMBLR0IBH01e-106R0IBH0_9BRAS; Uncharacterized protein
STRINGAT1G17920.11e-102(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17003611
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17920.11e-105homeodomain GLABROUS 12